| Species : |
Pseudomona |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
PcrV is located at the needle end of T3SS and is involved in the translocation of toxins into host cells. PcrV is a well-conserved protein, with 98% homology among different isolates. |
| Molecular Mass : |
The protein has a calculated MW of 34 kDa. |
| AA Sequence : |
MGSSHHHHHHSSGLVPRGSHMEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI |
| Endotoxin : |
< 1 EU/μg by LAL |
| Purity : |
> 90% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.7 mg/mL by BCA |
| Storage Buffer : |
Sterile 50 mM Tris, pH 8.0, 100 mM NaCl |
