Recombinant Pseudomonas aeruginosa fimV Protein

• Cat.No.: fimV-131P
• Product Overview: Recombinant Pseudomonas aeruginosa fimV Protein was expressed in E. coli.

Specification

• Species: Pseudomonas aeruginosa
• Source: E.coli
• Description: motility protein FimV
• Form: Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
• Molecular Mass: ~29 kDa
• AA Sequence: DSFSLDDLSLDDSGHAAKPDAAGQDLDDAFDLSLDDLGGDDVQADLKSDSGALDDLTLDSDLDLAASTPADKPVDDLDFGLDFAELAETPSQPKHDDLGDFSLDLDAPEDKLSDDDFLLSLNDEVPAAAPADNEFTLDTEAAEEPALSLPDDFDLSLADEPTEPAAPEKGEDSFAAQLDEVSAQLDELASNLDEPKSATPSFSAEDAAVASALDGDADDDFDFLSGADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.4 mg/ml

Gene Information

• Gene Name: fimV motility protein FimV [ Pseudomonas aeruginosa PAO1 ]
• Official Symbol: fimV
• Gene ID: 879911
• Protein Refseq: NP_251805
• UniProt ID: Q9HZA6