Recombinant Pseudomonas Aeruginosa LECA Protein (2-122 aa), His-tagged

Cat.No. : LECA-867P
Product Overview : Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/PAO1/1C/PRS 101/LMG 12228) LECA Protein (2-122 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pseudomonas Aeruginosa
Source : E.coli
Tag : His
Protein Length : 2-122 aa
Description : D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hagglutinating activity.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 16.8 kDa
AA Sequence : AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
UniProt ID Q05097

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LECA Products

Required fields are marked with *

My Review for All LECA Products

Required fields are marked with *

0
cart-icon
0
compare icon