Recombinant Pseudomonas Aeruginosa LECA Protein (2-122 aa), His-tagged
Cat.No. : | LECA-867P |
Product Overview : | Recombinant Pseudomonas Aeruginosa (strain ATCC 15692/PAO1/1C/PRS 101/LMG 12228) LECA Protein (2-122 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Aeruginosa |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-122 aa |
Description : | D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hagglutinating activity. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 16.8 kDa |
AA Sequence : | AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
UniProt ID | Q05097 |
◆ Recombinant Proteins | ||
lecA-10P | Recombinant Pseudomonas aeruginosa galactophilic lectin, His tagged, Galactose Labeled | +Inquiry |
LECA-867P | Recombinant Pseudomonas Aeruginosa LECA Protein (2-122 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LECA Products
Required fields are marked with *
My Review for All LECA Products
Required fields are marked with *
0
Inquiry Basket