| Species : |
Pseudomonas Azotoformans |
| Source : |
E.coli |
| Tag : |
His&Myc&SUMO |
| Protein Length : |
1-310 aa |
| Description : |
Hydrolyzes L-prolinamide, L-proline-p-nitroanilide, L-alaninamide, L-methioninamide, piperidine-2-carboxamide and piperazine-2-carboxamide. Has a much lower activity towards piperazine-2-tert-butylcarboxamide. Does not hydrolyze dipeptides and D-prolinamide. |
| Form : |
Tris-based buffer,50% glycerol |
| Molecular Mass : |
54.5 kDa |
| AA Sequence : |
MEFIEKIREGYAAFGAYQTWYRVTGDLSSGRTPLVVIHGGPGCTHDYVDAFKDVAASGHAVIHYDQLGNGRSTHLPDKDPSFWTVGLFLEELNNLLDHLQISDNYAILGQSWGGMLGSEHAILQPKGLRAFIPANSPTCMRTWVSEANRLRKLLPEGVHETLLKHETAGTYQDPEYLAASRVFYDHHVCRVIPWPEEVARTFAAVDADPTVYHAMSGPTEFHVIGSLKDWKSTGRLSAINVPTLVISGRHDEATPLVVKPFLDEIADVRWALFEDSSHMPHVEERQACMGTVVKFLDEVCSAKYKVLKAS |
| Purity : |
> 90% as determined by SDS-PAGE. |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : |
A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |