Recombinant Rabbit APOE Protein, His/MYC-tagged
| Cat.No. : | APOE-1127R |
| Product Overview : | Recombinant Rabbit APOE Protein (20-311aa) was expressed in E. coli with N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 20-311 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 38.6 kDa |
| AA Sequence : | TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | APOE apolipoprotein E [ Oryctolagus cuniculus (rabbit) ] |
| Official Symbol | APOE |
| Synonyms | APOE; apolipoprotein E; apo-E |
| Gene ID | 100009337 |
| mRNA Refseq | NM_001082643.1 |
| Protein Refseq | NP_001076112.1 |
| UniProt ID | P18287 |
| ◆ Recombinant Proteins | ||
| APOE-4674H | Recombinant Human APOE protein, His-tagged, Biotinylated(Primary Amine Labeling) | +Inquiry |
| APOE-726R | Recombinant Full Length Rat apolipoprotein E Protein, His tagged | +Inquiry |
| APOE4-2866H | Recombinant Human APOE4 protein(C130R) | +Inquiry |
| APOE-2541R | Recombinant Rabbit APOE protein, His-SUMO & Myc-tagged | +Inquiry |
| Apoe-1129M | Recombinant Mouse Aope Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
| APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
| ApoE-3560H | Native Human ApoE | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOE Products
Required fields are marked with *
My Review for All APOE Products
Required fields are marked with *
