Recombinant Rabbit APOE Protein, His/MYC-tagged

Cat.No. : APOE-1127R
Product Overview : Recombinant Rabbit APOE Protein (20-311aa) was expressed in E. coli with N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : E.coli
Tag : His&Myc
Protein Length : 20-311 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 38.6 kDa
AA Sequence : TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name APOE apolipoprotein E [ Oryctolagus cuniculus (rabbit) ]
Official Symbol APOE
Synonyms APOE; apolipoprotein E; apo-E
Gene ID 100009337
mRNA Refseq NM_001082643.1
Protein Refseq NP_001076112.1
UniProt ID P18287

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOE Products

Required fields are marked with *

My Review for All APOE Products

Required fields are marked with *

0
cart-icon
0
compare icon