Recombinant Rabbit APOE protein, His-SUMO & Myc-tagged
| Cat.No. : | APOE-2541R |
| Product Overview : | Recombinant Rabbit APOE protein(P18287)(20-311aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 20-311aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 53.6 kDa |
| AA Sequence : | TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | APOE apolipoprotein E [ Oryctolagus cuniculus ] |
| Official Symbol | APOE |
| Synonyms | APOE; apolipoprotein E; apo-E; |
| Gene ID | 100009337 |
| mRNA Refseq | NM_001082643 |
| Protein Refseq | NP_001076112 |
| ◆ Recombinant Proteins | ||
| APOE-726R | Recombinant Full Length Rat apolipoprotein E Protein, His tagged | +Inquiry |
| Apoe-2199M | Recombinant Mouse Apoe protein, His&Myc-tagged | +Inquiry |
| APOE-1792M | Recombinant Mouse APOE Protein | +Inquiry |
| APOE4-2873H | Active Recombinant Human APOE4 protein, His-tagged | +Inquiry |
| APOE-2631H | Recombinant Human APOE | +Inquiry |
| ◆ Native Proteins | ||
| APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
| ApoE-3560H | Native Human ApoE | +Inquiry |
| APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOE Products
Required fields are marked with *
My Review for All APOE Products
Required fields are marked with *
