Recombinant Rabbit HINT1 Protein, His/MYC-tagged
| Cat.No. : | HINT1-1238R |
| Product Overview : | Recombinant Rabbit HINT1 Protein (2-126aa) was expressed in mammalian cells with N-terminal 10xHis-tag and C-terminal Myc-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | HEK293 |
| Tag : | His&Myc |
| Protein Length : | 2-126 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| AA Sequence : | ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADE SLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | HINT1 histidine triad nucleotide binding protein 1 [ Oryctolagus cuniculus (rabbit) ] |
| Official Symbol | HINT1 |
| Synonyms | HINT; HINT1; histidine triad nucleotide-binding protein 1; P13.7; adenosine 5'-monophosphoramidase |
| Gene ID | 100009302 |
| mRNA Refseq | NM_001082623.1 |
| Protein Refseq | NP_001076092.1 |
| UniProt ID | P80912 |
| ◆ Recombinant Proteins | ||
| HINT1-13779H | Recombinant Human HINT1, GST-tagged | +Inquiry |
| HINT1-3469HF | Recombinant Full Length Human HINT1 Protein, GST-tagged | +Inquiry |
| HINT1-1902R | Recombinant Rhesus Macaque HINT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HINT1-2081R | Recombinant Rhesus monkey HINT1 Protein, His-tagged | +Inquiry |
| HINT1-2845R | Recombinant Rat HINT1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HINT1-5558HCL | Recombinant Human HINT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT1 Products
Required fields are marked with *
My Review for All HINT1 Products
Required fields are marked with *
