Recombinant Rabbit HINT1 Protein, His/MYC-tagged

Cat.No. : HINT1-1238R
Product Overview : Recombinant Rabbit HINT1 Protein (2-126aa) was expressed in mammalian cells with N-terminal 10xHis-tag and C-terminal Myc-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : HEK293
Tag : His&Myc
Protein Length : 2-126 a.a.
Form : Tris-based buffer, 50% glycerol.
AA Sequence : ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADE
SLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name HINT1 histidine triad nucleotide binding protein 1 [ Oryctolagus cuniculus (rabbit) ]
Official Symbol HINT1
Synonyms HINT; HINT1; histidine triad nucleotide-binding protein 1; P13.7; adenosine 5'-monophosphoramidase
Gene ID 100009302
mRNA Refseq NM_001082623.1
Protein Refseq NP_001076092.1
UniProt ID P80912

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HINT1 Products

Required fields are marked with *

My Review for All HINT1 Products

Required fields are marked with *

0
cart-icon