Recombinant Rabbit INS protein
| Cat.No. : | INS-4330R |
| Product Overview : | Recombinant Rabbit INS protein(P01311)(25-54aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 25-54aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 3.4 kDa |
| AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | INS insulin [ Oryctolagus cuniculus ] |
| Official Symbol | INS |
| Synonyms | INS; insulin; |
| Gene ID | 100009181 |
| mRNA Refseq | NM_001082335 |
| Protein Refseq | NP_001075804 |
| ◆ Recombinant Proteins | ||
| INS-53H | Active Recombinant Human INS Protein | +Inquiry |
| INS-623CE | Recombinant Full Length Cynomolgus Monkey insulin Protein, His tagged | +Inquiry |
| INS-2368H | Recombinant Human INS Protein (Phe25-Thr54, Gly90-Thr110), N-His tagged | +Inquiry |
| INS-321H | Recombinant Human INS protein | +Inquiry |
| INS-14H | Active Recombinant Human Insulin, Low Endotoxin, Media Grade | +Inquiry |
| ◆ Native Proteins | ||
| INS-512D | Native Bovine INS | +Inquiry |
| INS-5435B | Native Bovine Insulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *



