Recombinant Rabbit INS protein

Cat.No. : INS-4330R
Product Overview : Recombinant Rabbit INS protein(P01311)(25-54aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : E.coli
Tag : Non
Protein Length : 25-54aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 3.4 kDa
AA Sequence : FVNQHLCGSHLVEALYLVCGERGFFYTPKS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name INS insulin [ Oryctolagus cuniculus ]
Official Symbol INS
Synonyms INS; insulin;
Gene ID 100009181
mRNA Refseq NM_001082335
Protein Refseq NP_001075804

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INS Products

Required fields are marked with *

My Review for All INS Products

Required fields are marked with *

0
cart-icon