Recombinant Rabbit INS protein
Cat.No. : | INS-4330R |
Product Overview : | Recombinant Rabbit INS protein(P01311)(25-54aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | Non |
Protein Length : | 25-54aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 3.4 kDa |
AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | INS insulin [ Oryctolagus cuniculus ] |
Official Symbol | INS |
Synonyms | INS; insulin; |
Gene ID | 100009181 |
mRNA Refseq | NM_001082335 |
Protein Refseq | NP_001075804 |
◆ Recombinant Proteins | ||
INS-6775C | Recombinant Chicken INS | +Inquiry |
INS-2689C | Recombinant Chicken INS Protein, His-tagged | +Inquiry |
INS-191HFL | Active Recombinant Full Length Human INS Protein, C-Flag-tagged | +Inquiry |
INS-676P | Recombinant Pig INS Protein, His/GST-tagged | +Inquiry |
INS-856H | Recombinant Human INS Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *