Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged
Cat.No. : | ITGB8-2297R |
Product Overview : | Recombinant Rabbit ITGB8 Protein (146-384 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 146-384 aa |
Description : | Integrin alpha-V/beta-8 is a receptor for fibronectin. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.9 kDa |
AA Sequence : | PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ITGB8 integrin, beta 8 [ Oryctolagus cuniculus ] |
Official Symbol | ITGB8 |
Synonyms | ITGB8; integrin, beta 8; integrin beta-8; integrin beta-8 subunit; |
Gene ID | 100009141 |
mRNA Refseq | NM_001082304 |
Protein Refseq | NP_001075773 |
UniProt ID | P26013 |
◆ Recombinant Proteins | ||
ITGB8-4964H | Recombinant Human ITGB8 Protein, GST-tagged | +Inquiry |
ITGB8-2317R | Recombinant Rhesus monkey ITGB8 Protein, His-tagged | +Inquiry |
ITGB8-183H | Recombinant Human ITGB8, GST-tagged | +Inquiry |
ITGB8-2297R | Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged | +Inquiry |
ITGB8-2138R | Recombinant Rhesus Macaque ITGB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB8-881HCL | Recombinant Human ITGB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB8 Products
Required fields are marked with *
My Review for All ITGB8 Products
Required fields are marked with *
0
Inquiry Basket