Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged

Cat.No. : ITGB8-2297R
Product Overview : Recombinant Rabbit ITGB8 Protein (146-384 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rabbit
Source : E.coli
Tag : His&Myc
Protein Length : 146-384 aa
Description : Integrin alpha-V/beta-8 is a receptor for fibronectin.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 31.9 kDa
AA Sequence : PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name ITGB8 integrin, beta 8 [ Oryctolagus cuniculus ]
Official Symbol ITGB8
Synonyms ITGB8; integrin, beta 8; integrin beta-8; integrin beta-8 subunit;
Gene ID 100009141
mRNA Refseq NM_001082304
Protein Refseq NP_001075773
UniProt ID P26013

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGB8 Products

Required fields are marked with *

My Review for All ITGB8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon