Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged
| Cat.No. : | ITGB8-2297R |
| Product Overview : | Recombinant Rabbit ITGB8 Protein (146-384 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 146-384 aa |
| Description : | Integrin alpha-V/beta-8 is a receptor for fibronectin. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 31.9 kDa |
| AA Sequence : | PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | ITGB8 integrin, beta 8 [ Oryctolagus cuniculus ] |
| Official Symbol | ITGB8 |
| Synonyms | ITGB8; integrin, beta 8; integrin beta-8; integrin beta-8 subunit; |
| Gene ID | 100009141 |
| mRNA Refseq | NM_001082304 |
| Protein Refseq | NP_001075773 |
| UniProt ID | P26013 |
| ◆ Recombinant Proteins | ||
| ITGB8-2138R | Recombinant Rhesus Macaque ITGB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGB8-4964H | Recombinant Human ITGB8 Protein, GST-tagged | +Inquiry |
| ITGB8-2220R | Recombinant Rabbit ITGB8 Protein, His-tagged | +Inquiry |
| ITGB8-2297R | Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged | +Inquiry |
| ITGB8-255H | Recombinant Human ITGB8 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB8-881HCL | Recombinant Human ITGB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB8 Products
Required fields are marked with *
My Review for All ITGB8 Products
Required fields are marked with *
