Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged

• Cat.No.: ITGB8-2297R
• Product Overview: Recombinant Rabbit ITGB8 Protein (146-384 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Rabbit
• Source: E.coli
• Tag: His&Myc
• Protein Length: 146-384 aa
• Description: Integrin alpha-V/beta-8 is a receptor for fibronectin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.9 kDa
• AA Sequence: PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ITGB8 integrin, beta 8 [ Oryctolagus cuniculus ]
• Official Symbol: ITGB8
• Synonyms: ITGB8; integrin, beta 8; integrin beta-8; integrin beta-8 subunit
• Gene ID: 100009141
• mRNA Refseq: NM_001082304
• Protein Refseq: NP_001075773
• UniProt ID: P26013