Recombinant Rat ACACA Protein (116-617 aa), His-tagged
Cat.No. : | ACACA-1862R |
Product Overview : | Recombinant Rat ACACA Protein (116-617 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 116-617 aa |
Description : | Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 57.8 kDa |
AA Sequence : | VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Acaca acetyl-CoA carboxylase alpha [ Rattus norvegicus ] |
Official Symbol | ACACA |
Synonyms | ACACA; acetyl-CoA carboxylase alpha; ACC-alpha; ACC1; Acac; |
Gene ID | 60581 |
mRNA Refseq | NM_022193 |
Protein Refseq | NP_071529 |
UniProt ID | P11497 |
◆ Recombinant Proteins | ||
ACACA-4123H | Recombinant Human ACACA protein, His-tagged | +Inquiry |
ACACA-375H | Recombinant Human ACACA protein, His/MBP-tagged | +Inquiry |
ACACA-377H | Recombinant Human ACACA protein, His/MBP-tagged | +Inquiry |
ACACA-435R | Recombinant Rat ACACA Protein | +Inquiry |
ACACA-1848H | Recombinant Human ACACA, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACACA Products
Required fields are marked with *
My Review for All ACACA Products
Required fields are marked with *
0
Inquiry Basket