Recombinant Rat AIF1 Protein (2-147 aa), His-tagged
Cat.No. : | AIF1-1323R |
Product Overview : | Recombinant Rat AIF1 Protein (2-147 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-147 aa |
Description : | Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.7 kDa |
AA Sequence : | SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Aif1 allograft inflammatory factor 1 [ Rattus norvegicus ] |
Official Symbol | AIF1 |
Synonyms | AIF1; AIF-1; iba1; Bart1; mrf-1; |
Gene ID | 29427 |
mRNA Refseq | NM_017196 |
Protein Refseq | NP_058892 |
UniProt ID | P55009 |
◆ Recombinant Proteins | ||
AIF1-1025B | Recombinant Bovine AIF1 protein, His&Myc-tagged | +Inquiry |
AIF1-411M | Recombinant Mouse AIF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AIF1-954HF | Recombinant Full Length Human AIF1 Protein, GST-tagged | +Inquiry |
Aif1-2497M | Recombinant Mouse Aif1 protein, His-tagged | +Inquiry |
AIF1-2496H | Recombinant Human AIF1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIF1 Products
Required fields are marked with *
My Review for All AIF1 Products
Required fields are marked with *
0
Inquiry Basket