Recombinant Rat BATF3 Protein (1-133 aa), His-tagged
Cat.No. : | BATF3-1339R |
Product Overview : | Recombinant Rat BATF3 Protein (1-133 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-133 aa |
Description : | AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Batf3 basic leucine zipper transcription factor, ATF-like 3 [ Rattus norvegicus ] |
Official Symbol | BATF3 |
Synonyms | BATF3; JDP-1; B-ATF-3; Jdp1; |
Gene ID | 60462 |
mRNA Refseq | NM_021865 |
Protein Refseq | NP_068637 |
UniProt ID | P97876 |
◆ Recombinant Proteins | ||
BATF3-5069H | Recombinant Human BATF3, His-tagged | +Inquiry |
Batf3-1826M | Recombinant Mouse Batf3 Protein, Myc/DDK-tagged | +Inquiry |
BATF3-969M | Recombinant Mouse BATF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
BATF3-1339R | Recombinant Rat BATF3 Protein (1-133 aa), His-tagged | +Inquiry |
BATF3-468H | Recombinant Human basic leucine zipper transcription factor, ATF-like 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BATF3-1656HCL | Recombinant Human BATF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BATF3 Products
Required fields are marked with *
My Review for All BATF3 Products
Required fields are marked with *
0
Inquiry Basket