Recombinant Rat BMP10 Protein, His tagged

Cat.No. : BMP10-999R
Product Overview : Recombinant Rat BMP10 Protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : His
Protein Length : 317-424 aa
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which binds to the activin receptor-like kinase 1 (ALK1) and plays important roles in cardiovascular development including cardiomyocyte proliferation and regulation of heart size, closure of the ductus arteriosus, angiogenesis and ventricular trabeculation.
AASequence : NAKGNYCKKTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLDPISILYLDKGVVTYKFKYEGMAVSECGCRHHHHHHHHHH
Molecular Mass : 13 kDa
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from PBS, pH7.4, 0.1% SKL, 5% Trehalose, 5% Mannitol
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
Gene Name BMP10 bone morphogenetic protein 10 [ Homo sapiens (human) ]
Official Symbol BMP10
Synonyms BMP10; bone morphogenetic protein 10; MGC126783
Gene ID 27302
mRNA Refseq NM_014482
Protein Refseq NP_055297
MIM 608748
UniProt ID O95393

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP10 Products

Required fields are marked with *

My Review for All BMP10 Products

Required fields are marked with *

0
cart-icon
0
compare icon