Recombinant Rat BMP10 Protein, His tagged

• Cat.No.: BMP10-999R
• Product Overview: Recombinant Rat BMP10 Protein with His tag was expressed in HEK293.

Specification

• Species: Rat
• Source: HEK293
• Tag: His
• Protein Length: 317-424 aa
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which binds to the activin receptor-like kinase 1 (ALK1) and plays important roles in cardiovascular development including cardiomyocyte proliferation and regulation of heart size, closure of the ductus arteriosus, angiogenesis and ventricular trabeculation.
• AASequence: NAKGNYCKKTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLDPISILYLDKGVVTYKFKYEGMAVSECGCRHHHHHHHHHH
• Molecular Mass: 13 kDa
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from PBS, pH7.4, 0.1% SKL, 5% Trehalose, 5% Mannitol
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.

Gene Information

• Gene Name: BMP10 bone morphogenetic protein 10 [ Homo sapiens (human) ]
• Official Symbol: BMP10
• Synonyms: BMP10; bone morphogenetic protein 10; MGC126783
• Gene ID: 27302
• mRNA Refseq: NM_014482
• Protein Refseq: NP_055297
• MIM: 608748
• UniProt ID: O95393