| Species : |
Rat |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
163 |
| Description : |
Trophic factor for dopamine neurons. Prevents the 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. |
| Form : |
Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. It is able to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons when immobilized at 5 - 25 µg/mL on a nitrocellulose-coated microplate. |
| Molecular Mass : |
Approximately 18.8 kDa, a single non-glycosylated polypeptide chain containing 163 amino acids. |
| AA Sequence : |
QGLEAGVRSRADCEVCKEFLNRFYNSLLTRGIDFSVDTIEEELISFCADTKGKENRLCYYLGATKDSATKILGEVTRPMSVHMPTVKICEKLKKMDSQICELKYEKKLDLESVDLWKMRVAELKQILHSWGEECRACAEKHDYVNLIKELAPKYVETRPQTEL |
| Endotoxin : |
Less than 0.1 EU/µg of rRtCDNF as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analyses. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |