Recombinant Rat Cryaa protein, His-tagged
Cat.No. : | Cryaa-4568R |
Product Overview : | Recombinant Rat Cryaa protein(P24623)(1-196 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-196 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 29.4 kDa |
AASequence : | MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Cryaa crystallin, alpha A [ Rattus norvegicus ] |
Official Symbol | Cryaa |
Synonyms | CRYAA; crystallin, alpha A; alpha-crystallin A chain; Crystallin, alpha polypeptide A; Crya1; Acry-1; |
Gene ID | 24273 |
mRNA Refseq | NM_012534 |
Protein Refseq | NP_036666 |
◆ Recombinant Proteins | ||
CRYAA-1925H | Recombinant Human CRYAA Protein, GST-tagged | +Inquiry |
CRYAA-850H | Recombinant Human CRYAA Protein, His-tagged | +Inquiry |
CRYAA-7877H | Recombinant Human CRYAA protein, GST-tagged | +Inquiry |
CRYAA-1994M | Recombinant Mouse CRYAA Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYAA-667H | Recombinant Human CRYAA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYAA-7267HCL | Recombinant Human CRYAA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cryaa Products
Required fields are marked with *
My Review for All Cryaa Products
Required fields are marked with *