Recombinant Rat Ctf1 protein
Cat.No. : | Ctf1-1174R |
Product Overview : | Recombinant Rat Ctf1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 203 |
Description : | Cardiotrophin1 (CT1) is a member of the cytokine family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF). CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung. Studies showed CT-1 which induces cardiac myocyte hypertrophy in vitro can bind to and activate the ILST/gp130 receptor. Rat CT1 encodes a 203 amino acid (a.a.) residue protein that lacks a hydrophobic signal peptide and it shares 94% a.a. and 79% a.a. sequence identity with human and murine CT-1. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile, 0.1 % TFA. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 21.4 kDa, a single non-glycosylated polypeptide chain containing 203 amino acids. |
AA Sequence : | MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA |
Endotoxin : | Less than 1 EU/μg of rRtCT-1 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ctf1 |
Official Symbol | Ctf1 |
Synonyms | CTF1; cardiotrophin 1; cardiotrophin-1; CT-1; |
Gene ID | 29201 |
mRNA Refseq | NM_017129 |
Protein Refseq | NP_058825 |
UniProt ID | Q63086 |
◆ Recombinant Proteins | ||
CTF1-238H | Active Recombinant Human CTF1 protein(Ser2-Ala201) | +Inquiry |
CTF1-1653R | Recombinant Rat CTF1 Protein | +Inquiry |
CTF1-136H | Recombinant Human Cardiotrophin-1, His-tagged | +Inquiry |
CTF1-122H | Active Recombinant Human CTF1 protein | +Inquiry |
CTF1-137H | Recombinant Human CTF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTF1-001HCL | Recombinant Human CTF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ctf1 Products
Required fields are marked with *
My Review for All Ctf1 Products
Required fields are marked with *
0
Inquiry Basket