Recombinant Rat Ctf1 protein
| Cat.No. : | Ctf1-1174R |
| Product Overview : | Recombinant Rat Ctf1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 203 |
| Description : | Cardiotrophin1 (CT1) is a member of the cytokine family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF). CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung. Studies showed CT-1 which induces cardiac myocyte hypertrophy in vitro can bind to and activate the ILST/gp130 receptor. Rat CT1 encodes a 203 amino acid (a.a.) residue protein that lacks a hydrophobic signal peptide and it shares 94% a.a. and 79% a.a. sequence identity with human and murine CT-1. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile, 0.1 % TFA. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
| Molecular Mass : | Approximately 21.4 kDa, a single non-glycosylated polypeptide chain containing 203 amino acids. |
| AA Sequence : | MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA |
| Endotoxin : | Less than 1 EU/μg of rRtCT-1 as determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Ctf1 |
| Official Symbol | Ctf1 |
| Synonyms | CTF1; cardiotrophin 1; cardiotrophin-1; CT-1; |
| Gene ID | 29201 |
| mRNA Refseq | NM_017129 |
| Protein Refseq | NP_058825 |
| UniProt ID | Q63086 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctf1 Products
Required fields are marked with *
My Review for All Ctf1 Products
Required fields are marked with *



