Recombinant Rat Cxcl17 protein
Cat.No. : | Cxcl17-932R |
Product Overview : | Recombinant Rat Cxcl17 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 97 |
Description : | CXCL17 also named Dendritic Cell and Monocyte Chemokine-like Protein (DMC) and VEGF Co-regulated Chemokine 1 (VCC-1), is a small cytokine belonging to the CXC chemokine family. It is constitutively expressed in the lung and can be detected in trachea, stomach and skeletal muscle. CXCL17 attracts dendritic cells and monocytes and is regulated in tumors. It may be a housekeeping chemokine regulating recruitment of nonactivated blood monocytes and immature dendritic cells into tissues and may play a role in the innate defense against infections. Mature human CXCL17 shares 73 %, 71 % and 64 % amino acid sequence identity with bovine, mouse and rat DMC, respectively. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/mg. |
Molecular Mass : | Approximately 11.5 kDa, a single non-glycosylated polypeptide chain containing 97 amino acids. |
AA Sequence : | SPNQEVARHHGDQHQAPRRWLWEGGQECDCKDWSLRVSKRKTTAVLEPPRKQCPCDHVKGSEKKNRRQKHHRKSQRPSRTCQQFLKRCQLASFTLPL |
Endotoxin : | Less than 1 EU/µg of rRtVCC-1/CXCL17 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Cxcl17 |
Official Symbol | Cxcl17 |
Synonyms | CXCL17; chemokine (C-X-C motif) ligand 17; VEGF co-regulated chemokine 1; RGD1304717; |
Gene ID | 308436 |
mRNA Refseq | NM_001107491 |
Protein Refseq | NP_001100961 |
UniProt ID | D4A875 |
◆ Recombinant Proteins | ||
Cxcl17-199R | Recombinant Rat Cxcl17 Protein, His/GST-tagged | +Inquiry |
CXCL17-367H | Recombinant Horse CXCL17 Protein, His-tagged | +Inquiry |
CXCL17-198H | Recombinant Human CXCL17 Protein, His/GST-tagged | +Inquiry |
Cxcl17-932R | Recombinant Rat Cxcl17 protein | +Inquiry |
CXCL17-494H | Recombinant Human chemokine (C-X-C motif) ligand 17, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl17 Products
Required fields are marked with *
My Review for All Cxcl17 Products
Required fields are marked with *
0
Inquiry Basket