Recombinant Rat Dio3 protein, His-tagged
Cat.No. : | Dio3-4042R |
Product Overview : | Recombinant Rat Dio3 protein(P49897)(63-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 63-304aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.5 kDa |
AA Sequence : | DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Dio3 deiodinase, iodothyronine, type III [ Rattus norvegicus ] |
Official Symbol | Dio3 |
Synonyms | DIO3; deiodinase, iodothyronine, type III; type III iodothyronine deiodinase; type 3 DI; type-III 5-deiodinase; deiodinase, iodothyronine, type 3; 5DIII; DIOIII; |
Gene ID | 29475 |
mRNA Refseq | NM_017210 |
Protein Refseq | NP_058906 |
◆ Recombinant Proteins | ||
DIO3-2629H | Recombinant Human DIO3 Protein, GST-tagged | +Inquiry |
DIO3-385R | Recombinant Rat DIO3 Protein, His/MBP-tagged | +Inquiry |
Dio3-5658R | Recombinant Rat Dio3 protein, His-tagged | +Inquiry |
DIO3-3832C | Recombinant Chicken DIO3 | +Inquiry |
Dio3-1342M | Recombinant Mouse Dio3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Dio3 Products
Required fields are marked with *
My Review for All Dio3 Products
Required fields are marked with *