Recombinant Rat Fabp3 protein, His-SUMO-tagged

Cat.No. : Fabp3-2881R
Product Overview : Recombinant Rat Fabp3 protein(P07483)(2-133aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 2-133aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.6 kDa
AA Sequence : ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Fabp3 fatty acid binding protein 3, muscle and heart [ Rattus norvegicus ]
Official Symbol Fabp3
Synonyms FABP3; fatty acid binding protein 3, muscle and heart; fatty acid-binding protein, heart; H-FABP; fatty acid-binding protein 3; heart fatty acid binding protein; Fatty acid binding protein 3 heart; fatty acid binding protein 3 heart; heart-type fatty acid-binding protein;
Gene ID 79131
mRNA Refseq NM_024162
Protein Refseq NP_077076

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fabp3 Products

Required fields are marked with *

My Review for All Fabp3 Products

Required fields are marked with *

0
cart-icon