Recombinant Rat FETUB Protein (19-378 aa), His-tagged
Cat.No. : | FETUB-2116R |
Product Overview : | Recombinant Rat FETUB Protein (19-378 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-378 aa |
Description : | Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 41.7 kDa |
AA Sequence : | RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Fetub fetuin B [ Rattus norvegicus ] |
Official Symbol | FETUB |
Synonyms | FETUB; fetuin B; fetuin-B; IRL685; fetuin beta; Fet; Pp63; |
Gene ID | 83928 |
mRNA Refseq | NM_053348 |
Protein Refseq | NP_445800 |
UniProt ID | Q9QX79 |
◆ Recombinant Proteins | ||
Fetub-1891R | Recombinant Rat Fetub protein, His-tagged | +Inquiry |
FETUB-3506H | Recombinant Human FETUB Protein (Met149-Asp255), N-GST tagged | +Inquiry |
Fetub-3800M | Recombinant Mouse Fetub protein(Met1-Pro388), His-tagged | +Inquiry |
FETUB-2315R | Recombinant Rat FETUB Protein | +Inquiry |
FETUB-1972R | Recombinant Rat FETUB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FETUB-2135MCL | Recombinant Mouse FETUB cell lysate | +Inquiry |
FETUB-2022HCL | Recombinant Human FETUB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FETUB Products
Required fields are marked with *
My Review for All FETUB Products
Required fields are marked with *