Recombinant Rat Full Length DIO2 Protein (1-266 aa), His-tagged
Cat.No. : | DIO2-1560R |
Product Overview : | Recombinant Rat DIO2 Protein (1-266 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-266 a.a. |
Description : | Catalyzes the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.8 kDa |
AA Sequence : | MGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Dio2 deiodinase, iodothyronine, type II [ Rattus norvegicus ] |
Official Symbol | DIO2 |
Synonyms | DIO2; type 2 DI; type-II 5-deiodinase; 5DII; DIOII; |
Gene ID | 65162 |
mRNA Refseq | NM_031720 |
Protein Refseq | NP_113908 |
UniProt ID | P70551 |
◆ Recombinant Proteins | ||
DIO2-1869R | Recombinant Rat DIO2 Protein | +Inquiry |
DIO2-2628H | Recombinant Human DIO2 Protein, GST-tagged | +Inquiry |
DIO2-1560R | Recombinant Rat Full Length DIO2 Protein (1-266 aa), His-tagged | +Inquiry |
Dio2-8147R | Recombinant Rat Dio2 protein, His & MBP-tagged | +Inquiry |
DIO2-2798H | Recombinant Human DIO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIO2 Products
Required fields are marked with *
My Review for All DIO2 Products
Required fields are marked with *
0
Inquiry Basket