Recombinant Rat Full Length DIO2 Protein (1-266 aa), His-tagged

• Cat.No.: DIO2-1560R
• Product Overview: Recombinant Rat DIO2 Protein (1-266 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 1-266 a.a.
• Description: Catalyzes the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.8 kDa
• AA Sequence: MGLLSVDLLITLQILPVFFSNCLFLALYDSVILLKHVALLLSRSKSTRGEWRRMLTSEGLRCVWNSFLLDAYKQVKLGEDAPNSSVVHVSNPEAGNNCASEKTADGAECHLLDFASAERPLVVNFGSATUPPFTRQLPAFRQLVEEFSSVADFLLVYIDEAHPSDGWAVPGDSSMSFEVKKHRNQEDRCAAAHQLLERFSLPPQCQVVADRMDNNANVAYGVAFERVCIVQRRKIAYLGGKGPFSYNLQEVRSWLEKNFSKRUILD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Dio2 deiodinase, iodothyronine, type II [ Rattus norvegicus ]
• Official Symbol: DIO2
• Synonyms: DIO2; type 2 DI; type-II 5-deiodinase; 5DII; DIOII
• Gene ID: 65162
• mRNA Refseq: NM_031720
• Protein Refseq: NP_113908
• UniProt ID: P70551