Recombinant Rat Fxn Protein, His-tagged
| Cat.No. : | Fxn-1218R |
| Product Overview : | Recombinant Rat Fxn Protein (41-208aa) was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 41-208 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 22.1 kDa |
| AA Sequence : | LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFED LADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSL HELLARELTEALNTKLDLSSLAYSGKGT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Fxn frataxin [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Fxn |
| Synonyms | RGD1565754; Fxn; Frataxin, mitochondrial; EC 1.16.3.1; Frataxin intermediate form; Frataxin mature form |
| Gene ID | 499335 |
| mRNA Refseq | NM_001191952.1 |
| Protein Refseq | NP_001178881.1 |
| UniProt ID | D3ZYW7 |
| ◆ Recombinant Proteins | ||
| FXN-2321H | Recombinant Human FXN Protein (Ser57-Leu198), N-His tagged | +Inquiry |
| FXN-1771R | Recombinant Rhesus monkey FXN Protein, His-tagged | +Inquiry |
| Fxn-1218R | Recombinant Rat Fxn Protein, His-tagged | +Inquiry |
| FXN-13051H | Recombinant Human FXN, His-tagged | +Inquiry |
| FXN-275C | Recombinant Cynomolgus Monkey FXN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fxn Products
Required fields are marked with *
My Review for All Fxn Products
Required fields are marked with *
