Recombinant Rat GLP1R Protein (22-135 aa), His-tagged
| Cat.No. : | GLP1R-2107R |
| Product Overview : | Recombinant Rat GLP1R Protein (22-135 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 22-135 aa |
| Description : | G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 15.1 kDa |
| AA Sequence : | GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ] |
| Official Symbol | GLP1R |
| Synonyms | GLP1R; GLP-1R; GLP-1-R; GLP-1 receptor; Glip; RATGL1RCP; |
| Gene ID | 25051 |
| mRNA Refseq | NM_012728 |
| Protein Refseq | NP_036860 |
| UniProt ID | P32301 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *



