Recombinant Rat GLP1R Protein (22-135 aa), His-tagged
Cat.No. : | GLP1R-2107R |
Product Overview : | Recombinant Rat GLP1R Protein (22-135 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 22-135 aa |
Description : | G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.1 kDa |
AA Sequence : | GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ] |
Official Symbol | GLP1R |
Synonyms | GLP1R; GLP-1R; GLP-1-R; GLP-1 receptor; Glip; RATGL1RCP; |
Gene ID | 25051 |
mRNA Refseq | NM_012728 |
Protein Refseq | NP_036860 |
UniProt ID | P32301 |
◆ Recombinant Proteins | ||
GLP1R-1229M | Recombinant Mouse GLP1R Protein, His-SUMO-tagged | +Inquiry |
GLP1R-1228H | Recombinant Human GLP1R Protein, His-tagged | +Inquiry |
Glp1r-04M | Recombinant Mouse Glp1r Protein, His-tagged | +Inquiry |
RFL7680MF | Recombinant Full Length Mouse Glucagon-Like Peptide 1 Receptor(Glp1R) Protein, His-Tagged | +Inquiry |
GLP1R-2565R | Recombinant Rat Glp1r protein, His/SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *
0
Inquiry Basket