Recombinant Rat GLP1R Protein (22-135 aa), His-tagged

Cat.No. : GLP1R-2107R
Product Overview : Recombinant Rat GLP1R Protein (22-135 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His
Protein Length : 22-135 aa
Description : G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 15.1 kDa
AA Sequence : GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Glp1r glucagon-like peptide 1 receptor [ Rattus norvegicus ]
Official Symbol GLP1R
Synonyms GLP1R; GLP-1R; GLP-1-R; GLP-1 receptor; Glip; RATGL1RCP;
Gene ID 25051
mRNA Refseq NM_012728
Protein Refseq NP_036860
UniProt ID P32301

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLP1R Products

Required fields are marked with *

My Review for All GLP1R Products

Required fields are marked with *

0
cart-icon
0
compare icon