Recombinant Rat Gmfb Protein (141 aa)
| Cat.No. : | Gmfb-034G |
| Product Overview : | Recombinant Rat Gmfb Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Protein Length : | 141 |
| Description : | Glia maturation factor beta(GMF-β) coded by GMFb gene at chromosome 14 in mouse, is identical to human GMF-β, with the exception of two amino acid residues. It is a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family, and plays an important role in the upstream regulation of excessive production and the releasing of proinflammatory cytokines/chemokines in brain cells, leading to the destruction of oligodendrocytes, the myelin forming cells, and neurons. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | Data not available. |
| Molecular Mass : | Approximately 16.4 KDa, a single non-glycosylated polypeptide chain containing 141 amino acid residues. |
| AA Sequence : | SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Endotoxin : | Less than 1 EU/μg of rMuGMF-β as determined by LAL method. |
| Purity : | >97% by SDS-PAGE and HPLC analyses. |
| Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Gmfb glia maturation factor, beta [ Rattus norvegicus ] |
| Official Symbol | Gmfb |
| Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF-beta; DNA for thyroid hormone receptor binding site (276bp); MGC93372; |
| Gene ID | 81661 |
| mRNA Refseq | NM_031032 |
| Protein Refseq | NP_112294 |
| UniProt ID | Q63228 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gmfb Products
Required fields are marked with *
My Review for All Gmfb Products
Required fields are marked with *



