| Species : |
Rat |
| Source : |
E.coli |
| Protein Length : |
141 |
| Description : |
Glia maturation factor beta(GMF-β) coded by GMFb gene at chromosome 14 in mouse, is identical to human GMF-β, with the exception of two amino acid residues. It is a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family, and plays an important role in the upstream regulation of excessive production and the releasing of proinflammatory cytokines/chemokines in brain cells, leading to the destruction of oligodendrocytes, the myelin forming cells, and neurons. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Data not available. |
| Molecular Mass : |
Approximately 16.4 KDa, a single non-glycosylated polypeptide chain containing 141 amino acid residues. |
| AA Sequence : |
SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Endotoxin : |
Less than 1 EU/μg of rMuGMF-β as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |