Recombinant Rat Gmfb Protein (141 aa)
Cat.No. : | Gmfb-034G |
Product Overview : | Recombinant Rat Gmfb Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 141 |
Description : | Glia maturation factor beta(GMF-β) coded by GMFb gene at chromosome 14 in mouse, is identical to human GMF-β, with the exception of two amino acid residues. It is a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family, and plays an important role in the upstream regulation of excessive production and the releasing of proinflammatory cytokines/chemokines in brain cells, leading to the destruction of oligodendrocytes, the myelin forming cells, and neurons. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Data not available. |
Molecular Mass : | Approximately 16.4 KDa, a single non-glycosylated polypeptide chain containing 141 amino acid residues. |
AA Sequence : | SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
Endotoxin : | Less than 1 EU/μg of rMuGMF-β as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Gmfb glia maturation factor, beta [ Rattus norvegicus ] |
Official Symbol | Gmfb |
Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF-beta; DNA for thyroid hormone receptor binding site (276bp); MGC93372; |
Gene ID | 81661 |
mRNA Refseq | NM_031032 |
Protein Refseq | NP_112294 |
UniProt ID | Q63228 |
◆ Recombinant Proteins | ||
GMFB-04H | Recombinant Human Glia Maturation Factor beta | +Inquiry |
GMFB-2585R | Recombinant Rat GMFB Protein | +Inquiry |
GMFB-8565H | Recombinant Human GMFB protein | +Inquiry |
GMFB-13333H | Recombinant Human GMFB, GST-tagged | +Inquiry |
GMFB-994H | Recombinant Human GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gmfb Products
Required fields are marked with *
My Review for All Gmfb Products
Required fields are marked with *
0
Inquiry Basket