Recombinant Rat Gmfb Protein (141 aa)

Cat.No. : Gmfb-034G
Product Overview : Recombinant Rat Gmfb Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 141
Description : Glia maturation factor beta(GMF-β) coded by GMFb gene at chromosome 14 in mouse, is identical to human GMF-β, with the exception of two amino acid residues. It is a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family, and plays an important role in the upstream regulation of excessive production and the releasing of proinflammatory cytokines/chemokines in brain cells, leading to the destruction of oligodendrocytes, the myelin forming cells, and neurons.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Data not available.
Molecular Mass : Approximately 16.4 KDa, a single non-glycosylated polypeptide chain containing 141 amino acid residues.
AA Sequence : SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Endotoxin : Less than 1 EU/μg of rMuGMF-β as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Gmfb glia maturation factor, beta [ Rattus norvegicus ]
Official Symbol Gmfb
Synonyms GMFB; glia maturation factor, beta; glia maturation factor beta; GMF-beta; DNA for thyroid hormone receptor binding site (276bp); MGC93372;
Gene ID 81661
mRNA Refseq NM_031032
Protein Refseq NP_112294
UniProt ID Q63228

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gmfb Products

Required fields are marked with *

My Review for All Gmfb Products

Required fields are marked with *

0
cart-icon
0
compare icon