Recombinant Rat Gmfb protein

Name: Recombinant Rat Gmfb protein
SKU: Gmfb-593R

Specification
Gene Information
Related Products
Download

Species :	Rat
Source :	E.coli
Tag :	Non
Protein Length :	141
Description :	The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells.
Form :	Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass :	Approximately 16.6 kDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
AA Sequence :	SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Endotoxin :	Less than 1 EU/μg of rRtGMF-β as determined by LAL method.
Purity :	>98% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Name	Gmfb
Official Symbol	Gmfb
Synonyms	GMFB; glia maturation factor, beta; glia maturation factor beta; GMF-beta; DNA for thyroid hormone receptor binding site (276bp); MGC93372;
Gene ID	81661
mRNA Refseq	NM_031032
Protein Refseq	NP_112294
UniProt ID	Q63228