Recombinant Rat Hbegf protein
Cat.No. : | Hbegf-592R |
Product Overview : | Recombinant Rat Hbegf protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 86 |
Description : | Heparin-binding epidermal growth factor (HB-EGF)-like growth factor (EGF) is found in cerebral neurons. Its expression is increased after hypoxic or ischemic injury, which also stimulates neurogenesis. HB-EGF has been implicated as a participant in a variety of normal physiological processes such as blastocyst implantation and wound healing, and in pathological processes such as tumor growth, SMC hyperplasia and atherosclerosis. HB-EGF is an 87 amino acid mitogenic and chemotactic glycoprotein containing an EGF-like domain with six conserved cysteine residues. Rat HB-EGF shares about 76 % a.a. sequence identity with human HB-EGF. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, 300 mM NaCl, pH 7.4, 5 % trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 9.7 kDa, a single non-glycosylated polypeptide chain containing 86 amino acids. |
AA Sequence : | DLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTL |
Endotoxin : | Less than 1 EU/μg of rRtHB-EGF as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Hbegf |
Official Symbol | Hbegf |
Synonyms | HBEGF, DT-R |
Gene ID | 25433 |
mRNA Refseq | NM_012945 |
Protein Refseq | NP_037077 |
UniProt ID | Q06175 |
◆ Recombinant Proteins | ||
Hbegf-564M | Recombinant Mouse Hbegf protein | +Inquiry |
HBEGF-269H | Active Recombinant Human HBEGF Protein | +Inquiry |
HBEGF-056H | Active Recombinant Human HBEGF Protein | +Inquiry |
HBEGF-4599H | Recombinant Human HBEGF Protein, GST-tagged | +Inquiry |
Hbegf-592R | Recombinant Rat Hbegf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hbegf Products
Required fields are marked with *
My Review for All Hbegf Products
Required fields are marked with *
0
Inquiry Basket