Recombinant Rat Hpx protein, His-tagged
Cat.No. : | Hpx-3052R |
Product Overview : | Recombinant Rat Hpx protein(P20059)(24-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-460aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.9 kDa |
AA Sequence : | NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Hpx hemopexin [ Rattus norvegicus ] |
Official Symbol | Hpx |
Synonyms | HPX; hemopexin; Hpxn; |
Gene ID | 58917 |
mRNA Refseq | NM_053318 |
Protein Refseq | NP_445770 |
◆ Recombinant Proteins | ||
HPX-4391H | Recombinant Human Hemopexin | +Inquiry |
HPX-2502H | Recombinant Human HPX Protein (Thr324-His462), N-His tagged | +Inquiry |
HPX-2908R | Recombinant Rat HPX Protein | +Inquiry |
HPX-3122H | Recombinant Human HPX Protein, His (Fc)-Avi-tagged | +Inquiry |
HPX-754H | Recombinant Human HPX protein(Met 1-His 462), His-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-206H | Native Human Native Human HPX | +Inquiry |
HPX-207H | Native Human Hemopexin | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
HPX-29307TH | Native Human HPX | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPX-2789HCL | Recombinant Human HPX cell lysate | +Inquiry |
HPX-2279MCL | Recombinant Mouse HPX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hpx Products
Required fields are marked with *
My Review for All Hpx Products
Required fields are marked with *