Recombinant Rat Il11 protein(22-199aa), hFc-tagged
| Cat.No. : | Il11-2232R |
| Product Overview : | Recombinant Rat Il11 protein(Q99MF5)(22-199aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 22-199aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Gene Name | Il11 interleukin 11 [ Rattus norvegicus ] |
| Official Symbol | Il11 |
| Synonyms | IL11; interleukin 11; interleukin-11; Il-11; |
| Gene ID | 171040 |
| mRNA Refseq | NM_133519 |
| Protein Refseq | NP_598203 |
| ◆ Recombinant Proteins | ||
| IL11-551H | Recombinant Human Interleukin 11 | +Inquiry |
| Il11-476R | Recombinant Rat Il11 protein, His-tagged | +Inquiry |
| IL11-137H | Recombinant Active Human IL11 Protein, His-tagged(N-ter) | +Inquiry |
| Il11-1374C | Recombinant Cynomolgus monkey Il11 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
| Il11-4756R | Recombinant Rat Il11 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il11 Products
Required fields are marked with *
My Review for All Il11 Products
Required fields are marked with *
