Recombinant Rat Il11 protein, His-PDI-tagged
Cat.No. : | Il11-4212R |
Product Overview : | Recombinant Rat Il11 protein(Q99MF5)(22-199aa), fused with N-terminal His and PDI tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His&PDI |
Protein Length : | 22-199aa |
Tag : | N-His-PDI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 78.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Gene Name | Il11 interleukin 11 [ Rattus norvegicus ] |
Official Symbol | Il11 |
Synonyms | IL11; interleukin 11; interleukin-11; Il-11; |
Gene ID | 171040 |
mRNA Refseq | NM_133519 |
Protein Refseq | NP_598203 |
◆ Recombinant Proteins | ||
IL11-130H | Active Recombinant Human IL11 Protein | +Inquiry |
Il11-476R | Recombinant Rat Il11 protein, His-tagged | +Inquiry |
IL11-175H | Active Recombinant Human IL11 Protein (Pro22-Leu199), N-His tagged, Animal-free, Carrier-free | +Inquiry |
IL11-137H | Recombinant Active Human IL11 Protein, His-tagged(N-ter) | +Inquiry |
IL11-1581H | Active Recombinant Human IL11 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il11 Products
Required fields are marked with *
My Review for All Il11 Products
Required fields are marked with *
0
Inquiry Basket