Recombinant Rat Kcne2 protein, His-tagged
| Cat.No. : | Kcne2-3130R |
| Product Overview : | Recombinant Rat Kcne2 protein(P63161)(1-123aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-123aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.4 kDa |
| AA Sequence : | MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Kcne2 potassium voltage-gated channel, Isk-related family, member 2 [ Rattus norvegicus ] |
| Official Symbol | Kcne2 |
| Synonyms | KCNE2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel subfamily E member 2; minK-related peptide 1; potassium channel subunit beta MiRP1; minimum potassium ion channel-related peptide 1; potassium voltage-gated channel, Isk-related subfamily, gene 2; Mirp1; MGC108602; |
| Gene ID | 171138 |
| mRNA Refseq | NM_133603 |
| Protein Refseq | NP_598287 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kcne2 Products
Required fields are marked with *
My Review for All Kcne2 Products
Required fields are marked with *



