Recombinant Rat Krtdap protein, His-SUMO-tagged
Cat.No. : | Krtdap-767R |
Product Overview : | Recombinant Rat Krtdap protein(P85411)(23-98aa), fused with N-terminal His tag and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-98aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AALGTPMEDTTSSNYPSGTEGLSEFLNFNKLQSAFKSDDFLNWHVLTDMFKKALPFINWEFFPKVKGLRSAVPDSQ |
◆ Recombinant Proteins | ||
Krtdap-1723R | Recombinant Rat Krtdap Protein, His&GST-tagged | +Inquiry |
KRTDAP-1598H | Recombinant Human KRTDAP | +Inquiry |
KRTDAP-8907M | Recombinant Mouse KRTDAP Protein | +Inquiry |
KRTDAP-2380H | Recombinant Human KRTDAP Protein, His-tagged | +Inquiry |
KRTDAP-4965M | Recombinant Mouse KRTDAP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTDAP-4837HCL | Recombinant Human KRTDAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Krtdap Products
Required fields are marked with *
My Review for All Krtdap Products
Required fields are marked with *
0
Inquiry Basket