Recombinant Rat Mbl2 protein(19-244aa), GST-tagged
| Cat.No. : | Mbl2-4922R |
| Product Overview : | Recombinant Rat Mbl2 protein(P08661)(19-244aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 19-244aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD |
| Gene Name | Mbl2 mannose-binding lectin (protein C) 2 [ Rattus norvegicus ] |
| Official Symbol | Mbl2 |
| Synonyms | MBL2; mannose-binding lectin (protein C) 2; mannose-binding protein C; MBP-C; RARF/P28A; raRF p28A; mannan-binding protein; RA-reactive factor P28A subunit; mannose-binding protein C (liver); mannose binding lectin 2 (protein C); ra-reactive factor polysaccharide-binding component p28A; Ab2-001; Ab2-011; |
| Gene ID | 64668 |
| mRNA Refseq | NM_022704 |
| Protein Refseq | NP_073195 |
| ◆ Recombinant Proteins | ||
| Mbl2-7021R | Recombinant Rat Mbl2 protein, His-tagged | +Inquiry |
| MBL2-4509H | Recombinant Human MBL2 Protein (Glu21-Ile248), C-His tagged | +Inquiry |
| MBL2-2694R | Recombinant Rhesus monkey MBL2 Protein, His-tagged | +Inquiry |
| MBL2-373H | Recombinant Human mannose-binding lectin (protein C) 2, soluble, His-tagged | +Inquiry |
| Mbl2-0144M | Recombinant Mouse Mbl2 Protein (Full Length), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MBL2-001HCL | Recombinant Human MBL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mbl2 Products
Required fields are marked with *
My Review for All Mbl2 Products
Required fields are marked with *
