Recombinant Rat Mbl2 protein(19-244aa), GST-tagged

Cat.No. : Mbl2-4922R
Product Overview : Recombinant Rat Mbl2 protein(P08661)(19-244aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : GST
Protein Length : 19-244aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 51.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD
Gene Name Mbl2 mannose-binding lectin (protein C) 2 [ Rattus norvegicus ]
Official Symbol Mbl2
Synonyms MBL2; mannose-binding lectin (protein C) 2; mannose-binding protein C; MBP-C; RARF/P28A; raRF p28A; mannan-binding protein; RA-reactive factor P28A subunit; mannose-binding protein C (liver); mannose binding lectin 2 (protein C); ra-reactive factor polysaccharide-binding component p28A; Ab2-001; Ab2-011;
Gene ID 64668
mRNA Refseq NM_022704
Protein Refseq NP_073195

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mbl2 Products

Required fields are marked with *

My Review for All Mbl2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon