Recombinant Rat METRNL Protein (46-311 aa), His-tagged
Cat.No. : | METRNL-2527R |
Product Overview : | Recombinant Rat METRNL Protein (46-311 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 46-311 aa |
Description : | Hormone induced following exercise or cold exposure that promotes energy expenditure. Induced either in the skeletal muscle after exercise or in adipose tissue following cold exposure and is present in the circulation. Able to stimulate energy expenditure associated with the browning of the white fat depots and improves glucose tolerance. Does not promote an increase in a thermogenic gene program via direct action on adipocytes, but acts by stimulating several immune cell subtypes to enter the adipose tissue and activate their prothermogenic actions. Stimulates an eosinophil-dependent increase in IL4 expression and promotes alternative activation of adipose tissue macrophages, which are required for the increased expression of the thermogenic and anti-inflammatory gene programs in fat. Required for some cold-induced thermogenic responses, suggesting a role in metabolic adaptations to cold temperatures. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.8 kDa |
AA Sequence : | QYSSDLCSWKGSGLTREAHSKEVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDVRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIHLRVSRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQKMYRKAEERGINPCEINME |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Metrnl meteorin-like, glial cell differentiation regulator [ Rattus norvegicus (Norway rat) ] |
Official Symbol | METRNL |
Synonyms | Metrnl; |
Gene ID | 316842 |
mRNA Refseq | NM_001014104 |
Protein Refseq | NP_001014126 |
UniProt ID | Q5RJL6 |
◆ Recombinant Proteins | ||
Metrnl-6754M | Recombinant Mouse Metrnl Protein (Glu67-Glu311), N-His tagged | +Inquiry |
METRNL-3928H | Recombinant Human METRNL protein(46-311aa), GST-tagged | +Inquiry |
METRNL-5486M | Recombinant Mouse METRNL Protein, His (Fc)-Avi-tagged | +Inquiry |
METRNL-5107H | Recombinant Human METRNL protein, His-tagged | +Inquiry |
METRNL-3312R | Recombinant Rat METRNL Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METRNL Products
Required fields are marked with *
My Review for All METRNL Products
Required fields are marked with *
0
Inquiry Basket