Recombinant Rat NQO2 Protein (1-231 aa), His-SUMO-tagged
Cat.No. : | NQO2-1032R |
Product Overview : | Recombinant Rat NQO2 Protein (1-231 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-231 aa |
Description : | The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 42.3 kDa |
AA Sequence : | MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Nqo2 NAD(P)H dehydrogenase, quinone 2 [ Rattus norvegicus ] |
Official Symbol | NQO2 |
Synonyms | NQO2; QR2; quinone reductase 2; MGC94180; |
Gene ID | 291084 |
mRNA Refseq | NM_001004214 |
Protein Refseq | NP_001004214 |
UniProt ID | Q6AY80 |
◆ Recombinant Proteins | ||
NQO2-1718M | Recombinant Mouse NQO2 Protein (1-231 aa), His-tagged | +Inquiry |
Nqo2-4483M | Recombinant Mouse Nqo2 Protein, Myc/DDK-tagged | +Inquiry |
NQO2-4059R | Recombinant Rat NQO2 Protein | +Inquiry |
NQO2-1145M | Recombinant Mouse NQO2 Protein (1-231 aa), His-SUMO-tagged | +Inquiry |
NQO2-139H | Recombinant Human NQO2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NQO2-3724HCL | Recombinant Human NQO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NQO2 Products
Required fields are marked with *
My Review for All NQO2 Products
Required fields are marked with *
0
Inquiry Basket