Recombinant Rat Plbd2 Protein, His-SUMO-tagged
Cat.No. : | Plbd2-1328R |
Product Overview : | Recombinant Rat Plbd2 Protein (36-585aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 36-585 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 77.9 kDa |
AA Sequence : | GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Plbd2 phospholipase B domain containing 2 [ Rattus norvegicus ] |
Official Symbol | Plbd2 |
Synonyms | P76; Plbd2; LAMA-like protein 2; RDCR-0918-3 protein; lamina ancestor homolog 2; mannose-6-phosphate protein p76; phospholipase B domain-containing protein 2 |
Gene ID | 246120 |
mRNA Refseq | NM_139255.3 |
Protein Refseq | NP_640348.2 |
UniProt ID | Q4QQW8 |
◆ Recombinant Proteins | ||
PLBD2-2112H | Recombinant Human PLBD2 Protein, MYC/DDK-tagged | +Inquiry |
PLBD2-249H | Recombinant Human PLBD2, His tagged | +Inquiry |
PLBD2-1701H | Recombinant Human PLBD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLBD2-3371C | Recombinant Chinese hamster PLBD2 protein(Leu38-Asp585), His-tagged | +Inquiry |
Plbd2-016H | Recombinant Hamster phospholipase B domain containing 2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLBD2-922HCL | Recombinant Human PLBD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Plbd2 Products
Required fields are marked with *
My Review for All Plbd2 Products
Required fields are marked with *