Recombinant Rat Plbd2 Protein, His-SUMO-tagged

Cat.No. : Plbd2-1328R
Product Overview : Recombinant Rat Plbd2 Protein (36-585aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 36-585 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 77.9 kDa
AA Sequence : GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Plbd2 phospholipase B domain containing 2 [ Rattus norvegicus ]
Official Symbol Plbd2
Synonyms P76; Plbd2; LAMA-like protein 2; RDCR-0918-3 protein; lamina ancestor homolog 2; mannose-6-phosphate protein p76; phospholipase B domain-containing protein 2
Gene ID 246120
mRNA Refseq NM_139255.3
Protein Refseq NP_640348.2
UniProt ID Q4QQW8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Plbd2 Products

Required fields are marked with *

My Review for All Plbd2 Products

Required fields are marked with *

0
cart-icon