Recombinant Rat Pnp protein, His-tagged
| Cat.No. : | Pnp-2425R |
| Product Overview : | Recombinant Rat Pnp protein(P85973)(1-289aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Insect cells |
| Tag : | His |
| Protein Length : | 1-289aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MENEFTYEDYQRTAEWLRSHTKHRPQVAVICGSGLGGLTAKLTQPQAFDYNEIPNFPQSTVQGHAGRLVFGFLNGRSCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFNAWKQMGEQRELQEGTYIMSAGPTFETVAESCLLRMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYNNLEKASHQEVLEAGKAAAQKLEQFVSILMESIPPRERAN |
| Gene Name | Pnp purine nucleoside phosphorylase [ Rattus norvegicus ] |
| Official Symbol | Pnp |
| Synonyms | PNP; purine nucleoside phosphorylase; inosine phosphorylase; nucleoside phosphorylase; Np; |
| Gene ID | 290029 |
| mRNA Refseq | NM_001106031 |
| Protein Refseq | NP_001099501 |
| ◆ Recombinant Proteins | ||
| PNP-3494R | Recombinant Rhesus monkey PNP Protein, His-tagged | +Inquiry |
| PNP-2498H | Recombinant Human PNP protein(11-280 aa), C-His-tagged | +Inquiry |
| PNP-715HFL | Active Recombinant Full Length Human PNP Protein, C-Flag-tagged | +Inquiry |
| Pnp-7995R | Recombinant Rat Pnp protein, His & T7-tagged | +Inquiry |
| PNP-1101H | Active Recombinant Human PNP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PNP-3071HCL | Recombinant Human PNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pnp Products
Required fields are marked with *
My Review for All Pnp Products
Required fields are marked with *
