Recombinant Rat Prl protein, His-tagged
| Cat.No. : | Prl-565R |
| Product Overview : | Recombinant Rat Prl protein(P01237)(30-226aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 30-226aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC |
| Gene Name | Prl prolactin [ Rattus norvegicus ] |
| Official Symbol | Prl |
| Synonyms | PRL; prolactin; prolactin family 1, subfamily a, member 1; PRLB; Prol; PRLSD1; Prl1a1; RNPROL; RATPRLSD1; |
| Gene ID | 24683 |
| mRNA Refseq | NM_012629 |
| Protein Refseq | NP_036761 |
| ◆ Recombinant Proteins | ||
| prl-1197Z | Recombinant Zebrafish prl Protein, His&GST-tagged | +Inquiry |
| PRL-2512H | Recombinant Human PRL protein(91-170 aa), C-His-tagged | +Inquiry |
| PRL-229R | Recombinant Rat Prolactin / PRL Protein, Monomer | +Inquiry |
| PRL-5500P | Recombinant Pig PRL protein, His-tagged | +Inquiry |
| PRL-59O | Recombinant Ovine Prolactin, 199aa | +Inquiry |
| ◆ Native Proteins | ||
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| PRL-8245H | Native Human Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prl Products
Required fields are marked with *
My Review for All Prl Products
Required fields are marked with *
