Recombinant Rat Prolactin / PRL Protein, Monomer

Cat.No. : PRL-229R
Product Overview : Recombinant Rat PRL Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 30-226 a.a.
Description : Prolactin is a hormone that is produced and secreted by the pituitary gland. Prolactin acts in an endocrine, paracrine, and autocrine manner. The prolactin receptor (PRLR) is expressed on many cell types, including cells of the reproductive organs, central nervous system, and breast cancer. Prolactin signal transduction occurs via JAK kinase signaling pathways. The primary function of prolactin is to regulate lactation, but prolactin also plays functional roles in the immune system and during cell growth, apoptosis, and differentiation.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 22.7 kDa (198 aa)
AA Sequence : MLPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Prl prolactin [ Rattus norvegicus (Norway rat) ]
Official Symbol PRL
Synonyms PRL; prolactin; prolactin family 1, subfamily a, member 1; PRLB; Prol; PRLSD1; Prl1a1; RNPROL; RATPRLSD1;
Gene ID 24683
mRNA Refseq NM_012629
Protein Refseq NP_036761
UniProt ID P01237

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRL Products

Required fields are marked with *

My Review for All PRL Products

Required fields are marked with *

0
cart-icon