Recombinant Rat PTH1R Protein, His-tagged
| Cat.No. : | PTH1R-4819R |
| Product Overview : | Recombinant Rat PTH1R Protein, His-tagged, expressed in HEK293. |
| Availability | November 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 27-188 aa |
| Tag : | His |
| Molecular Mass : | 20 kDa |
| AA Sequence : | DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.11mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Gene Name | Pth1r parathyroid hormone 1 receptor [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | PTH1R |
| Synonyms | Pthr; Pthr1; PTHrel; PTH1R |
| Gene ID | 56813 |
| mRNA Refseq | NM_020073 |
| Protein Refseq | NP_064458 |
| UniProt ID | P25961 |
| ◆ Cell & Tissue Lysates | ||
| PTH1R-1841HCL | Recombinant Human PTH1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTH1R Products
Required fields are marked with *
My Review for All PTH1R Products
Required fields are marked with *
Recently Viewed
