Recombinant Rat Rbp4 protein, His-tagged
Cat.No. : | Rbp4-4433R |
Product Overview : | Recombinant Rat Rbp4 protein(P04916)(19-201aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-201aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLTPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL |
Gene Name | Rbp4 retinol binding protein 4, plasma [ Rattus norvegicus ] |
Official Symbol | Rbp4 |
Synonyms | RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; RBPA; |
Gene ID | 25703 |
mRNA Refseq | NM_013162 |
Protein Refseq | NP_037294 |
◆ Recombinant Proteins | ||
Rbp4-2928M | Recombinant Mouse Rbp4 protein(19-201aa), hFc-tagged | +Inquiry |
RBP4-1421HFL | Recombinant Full Length Human RBP4 Protein, C-Flag-tagged | +Inquiry |
RBP4-738H | Recombinant Human RBP4 Protein, MYC/DDK-tagged | +Inquiry |
Rbp4-448R | Recombinant Rat Rbp4, His-tagged | +Inquiry |
RBP4-1036C | Active Recombinant Canine RBP4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP4-2271RCL | Recombinant Rat RBP4 cell lysate | +Inquiry |
RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rbp4 Products
Required fields are marked with *
My Review for All Rbp4 Products
Required fields are marked with *