Recombinant Rat Rbp4 protein, His-tagged
| Cat.No. : | Rbp4-4433R |
| Product Overview : | Recombinant Rat Rbp4 protein(P04916)(19-201aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-201aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLTPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL |
| Gene Name | Rbp4 retinol binding protein 4, plasma [ Rattus norvegicus ] |
| Official Symbol | Rbp4 |
| Synonyms | RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; RBPA; |
| Gene ID | 25703 |
| mRNA Refseq | NM_013162 |
| Protein Refseq | NP_037294 |
| ◆ Recombinant Proteins | ||
| RBP4-52H | Recombinant Human RBP4 | +Inquiry |
| RBP4-1275H | Active Recombinant Human RBP4 protein, hFc&His-tagged | +Inquiry |
| Rbp4-446M | Recombinant Mouse Rbp4, His-tagged | +Inquiry |
| Rbp4-447M | Recombinant Mouse Rbp4, FLAG-tagged | +Inquiry |
| RBP4-354H | Active Recombinant Human RBP4 Protein (Glu19-Leu201), C-6×His tagged | +Inquiry |
| ◆ Native Proteins | ||
| RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
| RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
| RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
| RBP4-2271RCL | Recombinant Rat RBP4 cell lysate | +Inquiry |
| RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rbp4 Products
Required fields are marked with *
My Review for All Rbp4 Products
Required fields are marked with *
