Recombinant Rat SHH Protein

• Cat.No.: SHH-242R
• Product Overview: Recombinant Rat SHH Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Description: Sonic hedgehog (SHH) is a member of a small group of hedgehog secreted proteins that are essential for development in both vertebrates and invertebrates.
• Bio-activity: No biological activity data is available at this time.
• AA Sequence: MIIGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG
• Endotoxin: ≤1 EUs/μg, Kinetic LAL (50% confidence)
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: Shh sonic hedgehog [ Rattus norvegicus (Norway rat) ]
• Official Symbol: SHH
• Synonyms: SHH; sonic hedgehog; sonic hedgehog protein; sonic hedgehog homolog
• Gene ID: 29499
• mRNA Refseq: NM_017221
• Protein Refseq: NP_058917
• UniProt ID: Q63673