Recombinant Rat SHH Protein

Cat.No. : SHH-242R
Product Overview : Recombinant Rat SHH Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Sonic hedgehog (SHH) is a member of a small group of hedgehog secreted proteins that are essential for development in both vertebrates and invertebrates.
Bio-activity : No biological activity data is available at this time.
AA Sequence : MIIGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG
Endotoxin : ≤1 EUs/μg, Kinetic LAL (50% confidence)
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution:
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Gene Name Shh sonic hedgehog [ Rattus norvegicus (Norway rat) ]
Official Symbol SHH
Synonyms SHH; sonic hedgehog; sonic hedgehog protein; sonic hedgehog homolog;
Gene ID 29499
mRNA Refseq NM_017221
Protein Refseq NP_058917
UniProt ID Q63673

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SHH Products

Required fields are marked with *

My Review for All SHH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon