Recombinant Rat SHH Protein
| Cat.No. : | SHH-242R |
| Product Overview : | Recombinant Rat SHH Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Description : | Sonic hedgehog (SHH) is a member of a small group of hedgehog secreted proteins that are essential for development in both vertebrates and invertebrates. |
| Bio-activity : | No biological activity data is available at this time. |
| AA Sequence : | MIIGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Gene Name | Shh sonic hedgehog [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | SHH |
| Synonyms | SHH; sonic hedgehog; sonic hedgehog protein; sonic hedgehog homolog; |
| Gene ID | 29499 |
| mRNA Refseq | NM_017221 |
| Protein Refseq | NP_058917 |
| UniProt ID | Q63673 |
| ◆ Recombinant Proteins | ||
| SHH-5391R | Recombinant Rat SHH Protein | +Inquiry |
| Shh-6804M | Recombinant Mouse Shh Protein (Cys25-Gly198) | +Inquiry |
| SHH-527H | Recombinant Human SHH Protein | +Inquiry |
| SHH-36H | Recombinant Human SHH Protein | +Inquiry |
| Shh-9029M | Active Recombinant Mouse Shh | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SHH-1494HCL | Recombinant Human SHH cell lysate | +Inquiry |
| SHH-1176MCL | Recombinant Mouse SHH cell lysate | +Inquiry |
| SHH-1533HCL | Recombinant Human SHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHH Products
Required fields are marked with *
My Review for All SHH Products
Required fields are marked with *




