Recombinant Rat SHH Protein
Cat.No. : | SHH-242R |
Product Overview : | Recombinant Rat SHH Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Sonic hedgehog (SHH) is a member of a small group of hedgehog secreted proteins that are essential for development in both vertebrates and invertebrates. |
Bio-activity : | No biological activity data is available at this time. |
AA Sequence : | MIIGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | Shh sonic hedgehog [ Rattus norvegicus (Norway rat) ] |
Official Symbol | SHH |
Synonyms | SHH; sonic hedgehog; sonic hedgehog protein; sonic hedgehog homolog; |
Gene ID | 29499 |
mRNA Refseq | NM_017221 |
Protein Refseq | NP_058917 |
UniProt ID | Q63673 |
◆ Recombinant Proteins | ||
SHH-30499TH | Recombinant Human SHH | +Inquiry |
SHH-36H | Recombinant Human SHH Protein | +Inquiry |
SHH-2484H | Recombinant Human Sonic Hedgehog Homolog (Drosophila), His-tagged | +Inquiry |
SHH-08H | Active Recombinant Human SHH Protein (Animal Free) | +Inquiry |
Shh-310S | Active Recombinant Mouse Shh Protein (176 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHH-1176MCL | Recombinant Mouse SHH cell lysate | +Inquiry |
SHH-1494HCL | Recombinant Human SHH cell lysate | +Inquiry |
SHH-1533HCL | Recombinant Human SHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHH Products
Required fields are marked with *
My Review for All SHH Products
Required fields are marked with *