Recombinant Rat SLC39A13 Protein (130-233 aa), His-GST-tagged
Cat.No. : | SLC39A13-1021R |
Product Overview : | Recombinant Rat SLC39A13 Protein (130-233 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 130-233 aa |
Description : | Acts as a zinc-influx transporter. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 41.2 kDa |
AA Sequence : | WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Slc39a13 solute carrier family 39 (zinc transporter), member 13 [ Rattus norvegicus ] |
Official Symbol | SLC39A13 |
Synonyms | SLC39A13; ZIP-13; MGC124816; |
Gene ID | 295928 |
mRNA Refseq | NM_001039196 |
Protein Refseq | NP_001034285 |
UniProt ID | Q2M1K6 |
◆ Recombinant Proteins | ||
SLC39A13-5190R | Recombinant Rat SLC39A13 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL22778DF | Recombinant Full Length Danio Rerio Zinc Transporter Zip13(Slc39A13) Protein, His-Tagged | +Inquiry |
SLC39A13-2718H | Recombinant Human SLC39A13 protein, His-tagged | +Inquiry |
SLC39A13-1849C | Recombinant Chicken SLC39A13 | +Inquiry |
SLC39A13-5531R | Recombinant Rat SLC39A13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A13-1722HCL | Recombinant Human SLC39A13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A13 Products
Required fields are marked with *
My Review for All SLC39A13 Products
Required fields are marked with *
0
Inquiry Basket