Recombinant Rat SLC39A13 Protein (130-233 aa), His-GST-tagged

Cat.No. : SLC39A13-1021R
Product Overview : Recombinant Rat SLC39A13 Protein (130-233 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : GST&His
Protein Length : 130-233 aa
Description : Acts as a zinc-influx transporter.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 41.2 kDa
AA Sequence : WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Slc39a13 solute carrier family 39 (zinc transporter), member 13 [ Rattus norvegicus ]
Official Symbol SLC39A13
Synonyms SLC39A13; ZIP-13; MGC124816;
Gene ID 295928
mRNA Refseq NM_001039196
Protein Refseq NP_001034285
UniProt ID Q2M1K6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC39A13 Products

Required fields are marked with *

My Review for All SLC39A13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon