Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged
Cat.No. : | Sult1a1-1379R |
Product Overview : | Recombinant Rat Sult1a1 Protein (1-291aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-291 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Sult1a1 sulfotransferase family 1A member 1 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Sult1a1 |
Synonyms | Stm; Stp1; ASTIV; Mx-ST; PST-1; St1a1; Sult1a3; EC 2.8.2.1 |
Gene ID | 83783 |
mRNA Refseq | NM_031834.1 |
Protein Refseq | NP_114022.1 |
UniProt ID | P17988 |
◆ Recombinant Proteins | ||
SULT1A1-24H | Active Recombinant Human SULT1A1 Protein, His-tagged | +Inquiry |
SULT1A1-587H | Recombinant Human SULT1A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sult1a1-1379R | Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged | +Inquiry |
SULT1A1-6376H | Recombinant Human SULT1A1 Protein (Glu2-Leu295), His tagged | +Inquiry |
Sult1a1-3543M | Recombinant Mouse Sult1a1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1A1-1357HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
SULT1A1-1356HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sult1a1 Products
Required fields are marked with *
My Review for All Sult1a1 Products
Required fields are marked with *
0
Inquiry Basket