Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged
| Cat.No. : | Sult1a1-1379R |
| Product Overview : | Recombinant Rat Sult1a1 Protein (1-291aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 1-291 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 53.9 kDa |
| AA Sequence : | MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Sult1a1 sulfotransferase family 1A member 1 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Sult1a1 |
| Synonyms | Stm; Stp1; ASTIV; Mx-ST; PST-1; St1a1; Sult1a3; EC 2.8.2.1 |
| Gene ID | 83783 |
| mRNA Refseq | NM_031834.1 |
| Protein Refseq | NP_114022.1 |
| UniProt ID | P17988 |
| ◆ Recombinant Proteins | ||
| SULT1A1-5828R | Recombinant Rat SULT1A1 Protein | +Inquiry |
| Sult1a1-6750R | Recombinant Rat Sult1a1 protein, His-tagged | +Inquiry |
| SULT1A1-25H | Recombinant Human SULT1A1 Protein, DYKDDDDK-tagged | +Inquiry |
| SULT1A1-3921H | Recombinant Human SULT1A1 protein(Glu2-Leu295), His-tagged | +Inquiry |
| SULT1A1-88H | Active Recombinant Human SULT1A1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SULT1A1-1356HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
| SULT1A1-1357HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sult1a1 Products
Required fields are marked with *
My Review for All Sult1a1 Products
Required fields are marked with *
