Recombinant Rat Sult1a1 Protein, His-SUMO/MYC-tagged

Cat.No. : Sult1a1-1379R
Product Overview : Recombinant Rat Sult1a1 Protein (1-291aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 1-291 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 53.9 kDa
AA Sequence : MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Sult1a1 sulfotransferase family 1A member 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol Sult1a1
Synonyms Stm; Stp1; ASTIV; Mx-ST; PST-1; St1a1; Sult1a3; EC 2.8.2.1
Gene ID 83783
mRNA Refseq NM_031834.1
Protein Refseq NP_114022.1
UniProt ID P17988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sult1a1 Products

Required fields are marked with *

My Review for All Sult1a1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon