Recombinant Rat SULT1B1 Protein (1-299 aa), His-SUMO-Myc-tagged
Cat.No. : | SULT1B1-2374R |
Product Overview : | Recombinant Rat SULT1B1 Protein (1-299 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1-299 aa |
Description : | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. sulfonation of DOPA, tyrosine isomers and thyroid hormones such as 3,3',5-triiodothyronine and 3,3'-diiodothyronine. May play a role in the limitation of the production of L-DOPA and L-m-tyrosine and also in facilitating their excretion. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 54.8 kDa |
AA Sequence : | MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Sult1b1 sulfotransferase family 1B, member 1 [ Rattus norvegicus ] |
Official Symbol | SULT1B1 |
Synonyms | SULT1B1; sulfotransferase family 1B, member 1; |
Gene ID | 113967 |
UniProt ID | P52847 |
◆ Recombinant Proteins | ||
SULT1B1-5829R | Recombinant Rat SULT1B1 Protein | +Inquiry |
SULT1B1-2399H | Recombinant Human Sulfotransferase Family, Cytosolic, 1B, Member 1, His-tagged | +Inquiry |
SULT1B1-4375R | Recombinant Rhesus Macaque SULT1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SULT1B1-3048H | Recombinant Human SULT1B1, GST-tagged | +Inquiry |
SULT1B1-1783H | Recombinant Human SULT1B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SULT1B1-1352HCL | Recombinant Human SULT1B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SULT1B1 Products
Required fields are marked with *
My Review for All SULT1B1 Products
Required fields are marked with *
0
Inquiry Basket