Recombinant Rat Syn1 protein, His-tagged
Cat.No. : | Syn1-646R |
Product Overview : | Recombinant Rat Syn1 protein(P09951)(113-420aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 113-420a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQALPR |
Gene Name | Syn1 synapsin I [ Rattus norvegicus ] |
Official Symbol | Syn1 |
Synonyms | SYN1; synapsin I; synapsin-1; synapsin 1; |
Gene ID | 24949 |
mRNA Refseq | NM_001110782 |
Protein Refseq | NP_001104252 |
◆ Recombinant Proteins | ||
SYN1-6740Z | Recombinant Zebrafish SYN1 | +Inquiry |
SYN1-5519R | Recombinant Rat SYN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Syn1-7854R | Recombinant Rat Syn1 protein, His-tagged | +Inquiry |
SYN1-2673H | Recombinant Human SYN1 protein(601-690 aa), C-His-tagged | +Inquiry |
SYN1-461HFL | Recombinant Full Length Human SYN1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Syn1 Products
Required fields are marked with *
My Review for All Syn1 Products
Required fields are marked with *
0
Inquiry Basket