Recombinant Rat Syt2 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Syt2-4938R |
| Product Overview : | Recombinant Rat Syt2 protein(P29101)(1-422aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-422aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.7 kDa |
| AA Sequence : | MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Syt2 synaptotagmin II [ Rattus norvegicus ] |
| Official Symbol | Syt2 |
| Synonyms | SYT2; synaptotagmin II; synaptotagmin-2; sytII; synaptotagmin 2; SYNII; RATSYNII; |
| Gene ID | 24805 |
| mRNA Refseq | NM_012665 |
| Protein Refseq | NP_036797 |
| ◆ Recombinant Proteins | ||
| SYT2-1027HFL | Recombinant Full Length Human SYT2 Protein, C-Flag-tagged | +Inquiry |
| SYT2-5539R | Recombinant Rat SYT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYT2-4590R | Recombinant Rhesus monkey SYT2 Protein, His-tagged | +Inquiry |
| SYT2-4406R | Recombinant Rhesus Macaque SYT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL10500MF | Recombinant Full Length Mouse Synaptotagmin-2(Syt2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYT2-646HCL | Recombinant Human SYT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Syt2 Products
Required fields are marked with *
My Review for All Syt2 Products
Required fields are marked with *



