Recombinant Rat Syt2 Full Length Transmembrane protein, His-tagged
Cat.No. : | Syt2-4938R |
Product Overview : | Recombinant Rat Syt2 protein(P29101)(1-422aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-422aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Syt2 synaptotagmin II [ Rattus norvegicus ] |
Official Symbol | Syt2 |
Synonyms | SYT2; synaptotagmin II; synaptotagmin-2; sytII; synaptotagmin 2; SYNII; RATSYNII; |
Gene ID | 24805 |
mRNA Refseq | NM_012665 |
Protein Refseq | NP_036797 |
◆ Recombinant Proteins | ||
RFL5129RF | Recombinant Full Length Rat Synaptotagmin-2(Syt2) Protein, His-Tagged | +Inquiry |
SYT2-5880R | Recombinant Rat SYT2 Protein | +Inquiry |
SYT2-1913H | Recombinant Human SYT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SYT2-4406R | Recombinant Rhesus Macaque SYT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYT2-2150H | Recombinant Human SYT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYT2-646HCL | Recombinant Human SYT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Syt2 Products
Required fields are marked with *
My Review for All Syt2 Products
Required fields are marked with *
0
Inquiry Basket