Recombinant Rat Tgfbr2 protein, His&Myc-tagged

Cat.No. : Tgfbr2-2261R
Product Overview : Recombinant Rat Tgfbr2 protein(P38438)(24-166aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Insect Cells
Tag : His&Myc
Protein Length : 24-166aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20 kDa
AA Sequence : IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Tgfbr2 transforming growth factor, beta receptor II [ Rattus norvegicus ]
Official Symbol Tgfbr2
Synonyms TGFBR2; transforming growth factor, beta receptor II; TGF-beta receptor type-2; TGFR-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; transforming growth factor beta, receptor 2; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor beta receptor type II; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor; Tgfbr2T; TGF-beta 2;
Gene ID 81810
mRNA Refseq NM_031132
Protein Refseq NP_112394

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tgfbr2 Products

Required fields are marked with *

My Review for All Tgfbr2 Products

Required fields are marked with *

0
cart-icon
0
compare icon