Recombinant Human TGFBR2 Protein, 23-166aa, C-hIgG-His tagged
Cat.No. : | TGFBR2-05H |
Product Overview : | Recombinant human TGFBR2 (23-166aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | Fc&His |
Protein Length : | 23-166aa |
Description : | TGFBR2, as known as TGF-beta receptor type-2 isoform B, is a member of the serine and threonine protein kinase family and the TGF beta receptor subfamily. The type-2 receptor binds TGF-beta1 and TGF-beta3 with high affinity, and TGF-beta2 with a much lower affinity. It forms a heterodimeric complex with type1 receptor and is essential for signal transduction. Also, this protein may play an important role in TGF-beta2 binding and signaling in cells lacking TGFBR3. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Human TGF-beta3. The ED50 range ≤ 1 μg/mL. |
Molecular Mass : | 43.3 kDa (383aa) |
AA Sequence : | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
References : | 1. Wrana JL., et al. (1992) Cell 71:1003-1014. 2. Halper B., et al. (2015) Exerc. Immunol. Rev. 21:154-163. |
Gene Name | TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens (human) ] |
Official Symbol | TGFBR2 |
Synonyms | TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII; |
Gene ID | 7048 |
mRNA Refseq | NM_003242 |
Protein Refseq | NP_003233 |
MIM | 190182 |
UniProt ID | P37173 |
◆ Recombinant Proteins | ||
TGFBR2-229H | Recombinant Human TGFBR2 protein, Fc-tagged | +Inquiry |
TGFBR2-304H | Recombinant Human TGFBR2 Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
TGFBR2-9644Z | Recombinant Zebrafish TGFBR2 | +Inquiry |
TGFBR2-6039R | Recombinant Rat TGFBR2 Protein | +Inquiry |
TGFBR2-1251H | Active Recombinant Human TGFBR2 protein, hFc&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFBR2 Products
Required fields are marked with *
My Review for All TGFBR2 Products
Required fields are marked with *
0
Inquiry Basket