Recombinant Human TGFBR2 Protein, 23-166aa, C-hIgG-His tagged

• Cat.No.: TGFBR2-05H
• Product Overview: Recombinant human TGFBR2 (23-166aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect cells
• Tag: Fc&His
• Protein Length: 23-166aa
• Description: TGFBR2, as known as TGF-beta receptor type-2 isoform B, is a member of the serine and threonine protein kinase family and the TGF beta receptor subfamily. The type-2 receptor binds TGF-beta1 and TGF-beta3 with high affinity, and TGF-beta2 with a much lower affinity. It forms a heterodimeric complex with type1 receptor and is essential for signal transduction. Also, this protein may play an important role in TGF-beta2 binding and signaling in cells lacking TGFBR3.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human TGF-beta3. The ED50 range ≤ 1 μg/mL.
• Molecular Mass: 43.3 kDa (383aa)
• AA Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• References: 1. Wrana JL., et al. (1992) Cell 71:1003-1014.
  2. Halper B., et al. (2015) Exerc. Immunol. Rev. 21:154-163.

Gene Information

• Gene Name: TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens (human) ]
• Official Symbol: TGFBR2
• Synonyms: TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII
• Gene ID: 7048
• mRNA Refseq: NM_003242
• Protein Refseq: NP_003233
• MIM: 190182
• UniProt ID: P37173