Recombinant Rat Tmod2 protein
| Cat.No. : | Tmod2-5186R |
| Product Overview : | Recombinant Rat Tmod2 protein(P70566)(1-351 aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-351 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAA TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE EALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGQGRKGPVRNVVKGEKAKPVFEEPP NPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVRKFSLAATRSND PVALAFAEMLKVNKTLKSLNVESNFITGAGILALVEALRENDTLTEIKIDNQRQQLGTAV EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Tmod2 tropomodulin 2 [ Rattus norvegicus ] |
| Official Symbol | Tmod2 |
| Synonyms | TMOD2; tropomodulin 2; tropomodulin-2; N-Tmod; neuronal tropomodulin; |
| Gene ID | 58814 |
| mRNA Refseq | NM_031613 |
| Protein Refseq | NP_113801 |
| ◆ Recombinant Proteins | ||
| TMOD2-1035C | Recombinant Cynomolgus TMOD2 Protein, His-tagged | +Inquiry |
| Tmod2-5186R | Recombinant Rat Tmod2 protein | +Inquiry |
| TMOD2-17105M | Recombinant Mouse TMOD2 Protein | +Inquiry |
| TMOD2-1327Z | Recombinant Zebrafish TMOD2 | +Inquiry |
| Tmod2-5187R | Recombinant Rat Tmod2 protein, Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMOD2-916HCL | Recombinant Human TMOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmod2 Products
Required fields are marked with *
My Review for All Tmod2 Products
Required fields are marked with *
