Recombinant Rat Tmod2 protein, Avi-tagged, Biotinylated
| Cat.No. : | Tmod2-5187R | 
| Product Overview : | Biotinylated Recombinant Rat Tmod2 protein(P70566)(1-351 aa), fused with Avi tag, was expressed in E.coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Rat | 
| Source : | E.coli | 
| Tag : | Avi | 
| Protein Length : | 1-351 aa | 
| Conjugation/Label : | Biotin | 
| Form : | Tris/PBS-based buffer, 6% Trehalose. | 
| AASequence : | MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAA TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE EALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGQGRKGPVRNVVKGEKAKPVFEEPP NPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKALETNTHVRKFSLAATRSND PVALAFAEMLKVNKTLKSLNVESNFITGAGILALVEALRENDTLTEIKIDNQRQQLGTAV EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR | 
| Purity : | >85% (SDS-PAGE) | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| Conjugation : | Biotin | 
| Gene Name | Tmod2 tropomodulin 2 [ Rattus norvegicus ] | 
| Official Symbol | Tmod2 | 
| Synonyms | TMOD2; tropomodulin 2; tropomodulin-2; N-Tmod; neuronal tropomodulin; | 
| Gene ID | 58814 | 
| mRNA Refseq | NM_031613 | 
| Protein Refseq | NP_113801 | 
| ◆ Recombinant Proteins | ||
| Tmod2-5185R | Recombinant Rat Tmod2 protein | +Inquiry | 
| TMOD2-778C | Recombinant Cynomolgus Monkey TMOD2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Tmod2-5188R | Recombinant Rat Tmod2 protein | +Inquiry | 
| TMOD2-1327Z | Recombinant Zebrafish TMOD2 | +Inquiry | 
| TMOD2-4665R | Recombinant Rhesus Macaque TMOD2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| TMOD2-916HCL | Recombinant Human TMOD2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Tmod2 Products
Required fields are marked with *
My Review for All Tmod2 Products
Required fields are marked with *
  
        
    
      
            